SVGPrint
Low-resolution previewFull detail in the SVG download.
The Commercial and Political Atlas plate 159
Printable colour vector
Every colour as its own shape, ready to print or recolour.
Full detail for your next creation
Unlock once, create again and again. Yours to redownload and use in the editor, with no more sparks to spend.
9 colours
- Format
- SVG, each colour its own shape
- Best for
- UV printing
- License
- Public domain
- Credit required
- No
- From the pages of
- William Playfair, The Commercial and Political Atlas (1801)
chartgraphstatisticsdatatradebalancetimelineengravingplayfaircolourprintvectorised
Printing this file
Every colour in the original plate is its own shape, so it prints bold and clean, like a screen print. Open it in the Design Editor to resize it, recolour it or place it on a blank, then send it to a UV printer. To cut it in real colours, open the Inlay or Layered tab.
More anatomy and diagrams prints
See all anatomy and diagrams
Email Updates
Keep up with MyLaserTools.
Email me about new tools, product updates, tutorials, and occasional MyLaserTools offers. Unsubscribe at any time.
Tag us on Instagram
Share what you made with @mylasertools
Join our Facebook Group
Share creations, ask questions, get inspired
Contact & Follow
Resources
YXE Creations Craft Hub Inc
© 2026 MyLaserTools.com. All rights reserved.